- Recombinant Human Putative P2Y purinoceptor 10 (P2RY10)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1025412
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 38,774 Da
- E Coli or Yeast
- 1-339
- purinergic receptor P2Y, G-protein coupled, 10
- P2Y10, LYPSR2
- Putative P2Y purinoceptor 10 (P2RY10)
Sequence
MANLDKYTETFKMGSNSTSTAEIYCNVTNVKFQYSLYATTYILIFIPGLLANSAALWVLCRFISKKNKAIIFMINLSVADLAHVLSLPLRIYYYISHHWPFQRALCLLCFYLKYLNMYASICFLTCISLQRCFFLLKPFRARDWKRRYDVGISAAIWIVVGTACLPFPILRSTDLNNNKSCFADLGYKQMNAVALVGMITVAELAGFVIPVIIIAWCTWKTTISLRQPPMAFQGISERQKALRMVFMCAAVFFICFTPYHINFIFYTMVKETIISSCPVVRIALYFHPFCLCLASLCCLLDPILYYFMASEFRDQLSRHGSSVTRSRLMSKESGSSMIG